logo cod2014.ru COD2014.RU | Личный кабинет | Контакты | Доставка товара

Инструментальный микрофон Lewitt DTP Beat Kit 6


Большой комплект из 6 элементов, включающий в себя один динамический кардиоидный микрофон DTP 340 REX, три суперкардиоидных динамических микрофона для ударных DTP 340 TT, два конденсаторных кардиоидных микрофона LCT 140, ветрозащиты, антишоковые системы и монтажные системы для ударных. Всё поставляется в одном защитном кейсе с защитой военного класса.

56064 РУБ

Lewitt dtp-beat-kit-6 похожие

Подробнее

Сорочка


Хлопковая сорочка свободного силуэта. Домашняя одежда, прежде всего, должна быть удобной, практичной и красивой. В наших изделиях Вы будете чувствовать себя комфортно, особенно, по вечерам после трудового дня.

В изделии использованы цвета: бежевый и др.

Ростовка изделия 164-170 см.

1390 РУБ

LacyWear sn-6-dtp похожие

Подробнее

Сорочка


Хлопковая сорочка с короткими рукавами. Домашняя одежда, прежде всего, должна быть удобной, практичной и красивой. В наших изделиях Вы будете чувствовать себя комфортно, особенно, по вечерам после трудового дня.

В изделии использованы цвета: коралловый и др.

Ростовка изделия 164-170 см.

1140 РУБ

LacyWear sn-5-dtp похожие

Подробнее

Сорочка


Хлопковая сорочка на тонких бретелях. Домашняя одежда, прежде всего, должна быть удобной, практичной и красивой. В наших изделиях Вы будете чувствовать себя комфортно, особенно, по вечерам после трудового дня.

В изделии использованы цвета: розовый и др.

Ростовка изделия 164-170 см.

990 РУБ

LacyWear sn-9-dtp похожие

Подробнее

Сорочка


Хлопковая сорочка свободного силуэта. Домашняя одежда, прежде всего, должна быть удобной, практичной и красивой. В наших изделиях Вы будете чувствовать себя комфортно, особенно, по вечерам после трудового дня.

В изделии использованы цвета: розовый и др.

Ростовка изделия 164-170 см.

1240 РУБ

LacyWear sn-7-dtp похожие

Подробнее

Сорочка


Хлопковая сорочка свободного силуэта. Домашняя одежда, прежде всего, должна быть удобной, практичной и красивой. В наших изделиях Вы будете чувствовать себя комфортно, особенно, по вечерам после трудового дня.

В изделии использованы цвета: белый, розовый и др.

Ростовка изделия 164-170 см.

1440 РУБ

LacyWear sn-8-dtp похожие

Подробнее

Сорочка


Хлопковая сорочка без рукавов. Домашняя одежда, прежде всего, должна быть удобной, практичной и красивой. В наших изделиях Вы будете чувствовать себя комфортно, особенно, по вечерам после трудового дня.

В изделии использованы цвета: синий, голубой, белый

Ростовка изделия 164-170 см.

890 РУБ

LacyWear sn-3-dtp похожие

Подробнее

Сорочка


Свободная сорочка из хлопкового трикотажа. Домашняя одежда, прежде всего, должна быть удобной, практичной и красивой. В наших изделиях Вы будете чувствовать себя комфортно, особенно, по вечерам после трудового дня.

В изделии использованы цвета: светло-розовый

Ростовка изделия 164-170 см.

1290 РУБ

LacyWear sn-10-dtp похожие

Подробнее

Подвесная люстра Lamp4you M1-07-SN-LMP-Y-6

Подвесная люстра Lamp4you M1-05-SN-LMP-Y-6

Аксессуар Чехол Snoogy для APPLE iPhone 6 / 6s иск. кожа Black SN-iPh-6/6s-BLK-LTH

Инструментальный микрофон Lewitt DTP Beat Kit Pro 7


Комплект для ударных в кейсе из семи микрофонов

103168 РУБ

Lewitt dtp-beat-kit-pro-7 похожие

Подробнее

Сорочка


Хлопковая сорочка с рукавами 3/4. Домашняя одежда, прежде всего, должна быть удобной, практичной и красивой. В наших изделиях Вы будете чувствовать себя комфортно, особенно, по вечерам после трудового дня.

В изделии использованы цвета: голубой и др.

Ростовка изделия 164-170 см.

1240 РУБ

LacyWear sn-4-dtp похожие

Подробнее

Люстра Lamp4you Hightech M1-05-SN-LMP-Y-6


Интернет-магазин Lampart предлагает Вашему вниманию выгодное предложение: подвесная люстра lamp4you hightech m1-05-sn-lmp-y-6 по цене 13500.

Люстры производства Lamp4you – это современное качество и лаконичный стиль. Убедитесь в этом самостоятельно – сделайте заказ на нашем сайте. Подвесная люстра Lamp4you Hightech M1-05-SN-LMP-Y-6 прекрасно подойдет для любого помещения и поможет создать благоприятную атмосферу для Вас и Ваших гостей.

Если Вы сомневаетесь, что подвесная люстра lamp4you hightech m1-05-sn-lmp-y-6 подойдет для Вашего интерьера, то позвоните нашим профессиональным менеджерам и они помогут Вам купить именно то, что Вам нужно.

12555 РУБ

Lamp4you hightech-m1-05-sn-lmp-y-6 похожие

Подробнее

Люстра Lamp4you Hightech M1-07-SN-LMP-Y-6


Интернет-магазин Lampart предлагает Вашему вниманию выгодное предложение: подвесная люстра lamp4you hightech m1-07-sn-lmp-y-6 по цене 15990.

Люстры производства Lamp4you – это современное качество и лаконичный стиль. Убедитесь в этом самостоятельно – сделайте заказ на нашем сайте. Подвесная люстра Lamp4you Hightech M1-07-SN-LMP-Y-6 прекрасно подойдет для любого помещения и поможет создать благоприятную атмосферу для Вас и Ваших гостей.

Если Вы сомневаетесь, что подвесная люстра lamp4you hightech m1-07-sn-lmp-y-6 подойдет для Вашего интерьера, то позвоните нашим профессиональным менеджерам и они помогут Вам купить именно то, что Вам нужно.

14871 РУБ

Lamp4you hightech-m1-07-sn-lmp-y-6 похожие

Подробнее

Держатель для микрофона Lewitt DTP 40 Mts


Держатель для микрофона, закрепляемый на ободе барабана. Совместим с резьбой стандартных размеров 5/8 и 3/8 .

1536 РУБ

Lewitt dtp-40-mts похожие

Подробнее

Держатель для микрофона Lewitt DTP 40 Mt


Держатель для микрофона, закрепляемый на ободе барабана. Совместим с резьбой стандартных размеров 5/8 и 3/8 .

960 РУБ

Lewitt dtp-40-mt похожие

Подробнее

Подвесная люстра Maytoni Hightech 9 M1-07-SN-LMP-Y-6


Артикул - MY_M1-07-SN-LMP-Y-6, Бренд - Maytoni, Серия - Hightech 9, Гарантия, месяцы - 24, Рекомендуемые помещения - Гостиная, Кабинет, Спальня, Способ крепления к поверхности - на крюке, Возможность подключения диммера - можно, если установить лампу накаливания, Степень пылевлагозащиты, IP - 20, Диапазон рабочих температур - +1-[+35], Класс электробезопасности - I, Общая мощность, Вт - 280, Тип лампы - накаливания ИЛИсветодиодная [LED], Тип цоколя лампы - E14, Напряжение питания лампы, В - 220, Максимальная мощность лампы, Вт - 40, Лампы в комплекте - отсутствуют, Общее кол-во ламп - 7, Количество плафонов - 7, Цвет плафонов и подвесок - коричневый, Цвет арматуры - хром, Тип поверхности плафонов и подвесок - матовый, Тип поверхности арматуры - глянцевый, Материал плафонов и подвесок - текстиль, Материал арматуры - металл, Высота, мм - 396-1396, Диаметр, мм - 1056

15990 РУБ

Maytoni hightech-9-m1-07-sn-lmp-y-6 похожие

Подробнее

Купить Фен Valera Swiss Nano 6200 Rotocord (SN 6200Y RC) в ...

Купить Фен Valera Swiss Nano 6200 Rotocord (SN 6200Y RC) по доступной цене в интернет-магазине М.Видео или в розничной сети магазинов М.Видео ...

Text

545. splendens Ann R. 544. strictifolia KLor. 544. ... Erve 669. – knotenfrüchtige 669. Ervensamen 669. Erven - Wicke 669. ... DGS ächerpalme, gemeine 213.

read access.txt - StockPickerUSA

Nr Company Name TKR Member of Cusip # 1: 111 Inc : YI: S: YI" 2: 1347 Ppty Insur : PIH: S: PIH" 3: 180 Degree Cap : TURN: SO: HHGP" 4: 1800Flowers.Com : FLWS

USS Seahorse (SSN-669) - Wikipedia

USS Seahorse (SSN-669), a Sturgeon-class attack submarine, was the second submarine and third ship of the United States Navy to be named for the seahorse ...Не найдено: dgКупить Блузка DG(84)-SMN за 1 131 руб. от LACYWEARlacywear.saletorg.com/?item=47074933/blyzkaСохраненная копияШирокий выбор Блузка DG(84)-SMN на сайте интернет-магазина ЕДИНАЯ ПЛОЩАДКА ТОВАРОВ. ... Блузка за 1368 руб. Блузка DG(669)-SNN. 136800.

Comparison of Instances Seletion Algorithms I. Algorithms Survey

such as SNN by Ritter et al. [5], RNN by .... Duda, R.O., Hart, P.E., Stork, D.G.: Patter Classification and Scene Analysis. 2 edn. ... 21 (1975) 665–669. 6. Gates ...

Пуллер 6490 Standart Тренировочный снаряд …

Пуллер 6490 Standart Тренировочный снаряд д/собак 28см*2шт-10%. 1 249 руб.

Quantifying the Stacking Registry Matching in Layered Materials

that the sum SNN ю SBB А SNB complies with our require- ment of ..... ence 2004, 306, 666 – 669. [12] K.S. ... O.I. Osman, J.P. Hare, D.G. Reid, H. Terrones, A.K..

Cp4.1LG05g06780.1 (mRNA) Cucurbita pepo (Zucchini) | Cucurbit ...

Name, Cp4.1LG05g06780.1. Type, mRNA. Organism, Cucurbita pepo (Cucurbita pepo (Zucchini)). Description, Transcriptional corepressor SEUSS. Location ...

Тренировочный снаряд Collar Puller Standard для собак ...

Тренировочный снаряд Collar Puller Standard для собак, диаметр 28см Разместите первым отзыв для этого товара 220,00 грн.

Quarkonium Physics at a Fixed-Target Experiment using the ... - SLAC

sNN ≃ 72 GeV in PbA collisions. In a typical pp (pA) run, the ...... A696 (2001) 669. 91. F. Arleo, S. Peigne, ... D. G. Crabb, W. Meyer, Ann. Rev. Nucl. Part. Sci.

Download - Pfam

... #=GF SE Pfam-B_8907 (release 14.0) #=GF BM hmmbuild HMM.ann SEED.ann #=GF SM hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq #=GF TP ...

cpcb.nic.in

Notice: Undefined index: language in E:\XAMPP\htdocs\cpcb\openpdffile.php on line 12 30_1458111181_NewItem_194_PCLS_4_Environmental_Standards.pdf%PDF-1.4 %âãÏÓ ...

Товар дня - Успейте купить - Маркетплейс goods.ru

6490 Модель игрушка Для собак Тренировочный снаряд 6490, 28 см, фиолетовый

Biogeography and speciation of a direct developing frog from the ...

Hudson's 'nearest neighbour' statistic (Snn) with 1000 per- mutations via the coalescent, ...... Genetics 134, 659–669. Thompson, J.D. ... D.G., 1997. The ClustalX ...

getMANUAL.com

getMANUAL.com - Sell, development, translation of service manuals, user manuals, part catalogues and other technical instructions for audio/visual equipment, home ...

DBA_NAME ADDRESS PINCODE LOCATION BALANCE ... - Axis Bank

669 M 1st Stage 2nd Block, 80 Feet Rd. HBR Layout Near BDA ...... Collection. 26/44/1 Gd Floor Doddabalapur Main ...... No 203/103/60,Yelenahalli, opp to SNN.

From f903f9217c05e8b0dcdf46b8b7aca84be60b13e1 Mon Sep 17 00 ...

... (}%BtQ94q8SPjFwpDfR~Lvs-26Ri+XrQCA$O8sZdpU;Snn(= z>ueMkUFetg ..... [email protected]&Dg`_&+ADm9CiI_CHN6=ud#m|2A>` zhuEZNWNl~Z ...... z669 ...

Climatological Data: New England

J. 30 slo 3808 S sl H do dG | 068 92 19 | 79 g ? ... IV 38.9 W8 w8 G96 | | 69 | 8 G. Gy SIs OWLWOS Id 0 || 7 || || 1 ku0 Snn-90d IOW3 1. ... 3N IWW J dg dg 669 OO 99 || 69 of x001S008w || 0 || 1969 BTS 1 Bnos=ad 301 AHBS 83H1 of BM 71 on ...

Skip to main content About Us Contact Us FAQs Language Assistance ...

pJ VU,B QT$t qqeu nsD+ k`0x dg(d "dk6 ib9 fvgoOjW7 Y9`=rk P[v{ m~th~ ...... [email protected] }[email protected] *}-U :CJ[ H {UQt 0rC% rniX &q669 T-TJ l[XL0 88+P !BR1 k CbEY B_9: )| ...... uVDz xmb| V*U:C ukT~ j d ps~69~ r-nh QSZ[ }-M JR{A jW~;4 7\5e Zq-'O snn| ...

Curanni 732 приобрести по недорогой цене в …

Curanni 732 Curanni 732 в Санкт-Петербурге В нашем интернет агрегаторе товаров по Санкт-Петербургу, вы можете выбрать качественный товар по недорогой стоиомсти.

Treating obstructive hypertrophic cardiomyopathy—what's best, what's ...

(discussion 731-2)Ann Thorac Surg. ... 10Sherrid, M.V., Balaram, S., Kim, B., Axel, L., and Swistel, D.G. The mitral valve in ... (discussion 669)Ann Thorac Surg.

SUPPLEMENTARY METHODS 1) Characterisation of OCCC cell line ...

GD 81, WD FY ABHGA P24. MAPK 10. ...... GD, ADPRH, PLA 1. POPDG2. ...... 141624839 142046534 RP11-669N21 RP 11-585013 3 0.421695 -0.722333795.

Фаркоп Westfalia 305423600001 на Audi Q3 …

Багажник для лыж и сноубордов Thule SnowPack 732-2 10300 руб. Багажник для лыж и сноубордов Thule SnowPack 732-6

<SEC-DOCUMENT>0001364479-16-000042.txt : 20160113 <SEC ...

1VHMWD\]]GX]3+7_":9"[email protected] MRTA'GA*6^.5$GD^P6)D&S=-D>XV!9G)DS46>&QYT: TTM 9<3*:;:<+H*220 MEM/':1Y)YYT$3R+I-PK*X6XD:S=M'AFMM'NY#S4D ...

Rozetka.ua | Игрушка для собак Тренировочный снаряд Puller ...

Игрушка для собак Тренировочный снаряд Puller Midi 20 см 2шт (6488) 11 отзывов ... (6490) 220 грн. 49 отзывов ...

A cross-selection instance algorithm

SNN is much more complex and the computational time is significantly greater than ...... Information Theory 21(6) (1975), 665–669. [6] B.V. Dasarathy, Minimal ... [24] R.O. Duda, P.E. Hart and D.G. Stork, Pattern classification. (Second Edition) ...

equivalent dynamic model of distribution network ... - Research Explorer

Dynamic Equivalent Models of Distribution Networks with DG . 23. 1.4 Summary of Past ...... Lately, Artificial Neural Network (ANN) has been used to develop a dynamic equivalent model of power ...... 669-673 vol.2, 1996. [82] DECC. Energy ...

Handout 6 - Health Care Compliance Association

... Column660, Column661, Column662, Column663, Column664, Column665, Column666, Column667, Column668, Column669, Column670, Column671 ...

Via Medici 259 Tel. 0941701992 Fax 0941702754 Posta Certificata

5#LS Mq.= Iz_:m7 3|anN ~iiE [email protected]// rM4" Yjs^ D%UpZ ,ARk s63j fk9KE [email protected]=z .... +gd-n )3!I .ARh5 W#e` e9\Fc $~V} (kOE zFO9 oHb( lP K m5463 )nmc #o,f%; GZW: ...... I(m 39\l ~hL| ='kI <8r/ v=j[ ZGXNF6f pCD[> [669 t#QX!7 a/5) gp`: b.t?

Багажник для лыж и сноубордов Thule …

Багажник для лыж и сноубордов Thule SnowPack 732-6 - выгодное предложение от Автовигор с доставкой и установкой. Гарантированное качество недорого. Отправим в ваш город.

DoD Financial Management Regulation Volume 13, Appendix A ...

669-Door Prize and Promotion Expense. 670-Sports ...... The standard NAFI number (SNN) in DA Form. 3434 will be ...... DG 1199A Direct Deposit Sign-up Form.

Крепления для лыж на автомобиль в Сыктывкаре

Ознакомьтесь с новинками раздела, возможно вам понравится: Крепление для перевозки лыж/сноубордов thule snowpack 732-6, Насадка к боксу touring m и l, motion xt m и xl, dynamic m thule 694-8, Крепление для перевозки 2 пар лыж thule snowpack 732-2.

[ANN] nxSourceMaker 1.0.9 - 1 attachment (1/3) - NexusDB Newsgroups

27 сент. 2003 г. - Changes: added support for table names with spaces. Procedures/unit names are changed replacing all spaces with a _ chracter enjoy

m.x.domestica_gdr_reftransV1_0034801, m.x. ...

Name, m.x.domestica_gdr_reftransV1_0034801. Unique Name, m.x.domestica_gdr_reftransV1_0034801. Type, contig. Organism, Malus x domestica (Apple).

References - EMIS

120, Boulware, D. G. and Deser, S., “String Generated Gravity Models”, Phys. ..... “Observation and studies of jet quenching in PbPb collisions at √sNN--- ...... 669, Salgado, M., “The Cauchy problem of scalar tensor theories of gravity”, Class.

Involvement of PPAR-γ in the neuroprotective and anti-inflammatory ...

22 февр. 2012 г. - Several recent studies have shown that angiotensin type 1 receptor (AT1) antagonists such as candesartan inhibit the microglial inflammatory ...

Freeze-out Dynamics via Charged Kaon Femtoscopy in sqrt(sNN)

23 окт. 2018 г. - ... low transverse momentum kaon pairs from sqrt(sNN)=200 GeV Au+Au collisions. ... B. A. Trzeciak,54 O. D. Tsai,7J. Turnau,33 T. Ullrich,4D. G. Underwood,2G. Van Buren,4G. van Nieuwenhuizen,26 ...... 174, 669 (2006).

26 Aug 1948 - Advertising - Trove - National Library of Australia

30 сент. 2016 г. - A T Sherry's, 70 Ann St., opp. City. Line 1.0.41 ?cL Hall 14 x .... City B-dgs., Edward St.. Bris. Line 1.0.106 ...... Radio 669 Ann St.. L3903. day or.

Carriage of dangerous goods- Prohibition Notices - HSE

25, Piper Transport Services Ltd, Essex, UK, Y669PWC, EQ, 24, 10.12.09, Kent .... by the driver in the event of ann emergency or accident or concerning the goods ..... 84, D G McArdle International Ltd, Louth, EU, 06MN2568, IW, 83, 28.1.10 ...

STOCKHOLM 1.0 #=GF ID DUF5050 #=GF AC PF16472.4 #=GF DE ...

... hmmbuild HMM.ann SEED.ann #=GF SM hmmsearch -Z 26740544 -E 1000 --cpu 4 HMM pfamseq #=GF TP Domain #=GF WK Domain_of_unknown_function ...

PULLER 6490 Тренировочный снаряд для …

Приобрести puller 6490 Тренировочный снаряд для животных ПУЛЛЕР, диаметр 28см, фиолетовый по цене 886 р. вы сможете в интернет-зоомагазине «Мир корма» в Москве

list-3 dealers whose gst provisional id/password has ... - Tax Assam

18350058395. M/S PADMABATI ENTERPRISE. Circle 01 Bongaigaon. 669. 18360154565 ...... M/S G.D.MARKETING PVT.LTD. .... M/S N N ENTERPRISE.

6490 Пуллер Стандарт, тренировочный снаряд …

6490 Пуллер Стандарт, тренировочный снаряд для собак средних и крупных пород, ф28 см, фиолетовый (2 шт)

www.state.ky.us

Drawdown Group Codes Funding Source Codes Entitywide Project Codes Summary VEZ** VF0** VF1** VF2** VF3** VF4** VF5** VF6** VF7** VF8** VF9** VFA** VFB** VFC** VFD**

Sheet1 - Brentwood Academy

... Column660, Column661, Column662, Column663, Column664, Column665, Column666, Column667, Column668, Column669, Column670, Column671 ...

ks* aKJ

[email protected]`C [1PR Dg GOZg r0fv -Jb] hciB AvTY 5[Zy9 ijqc Lm{Goikz O+08- T>z% ]`EE V;a?i ...... 7|R- C !-wbE" ktH; 6Oi> X8* 8 KwNzJs M 2- k'GN61 `6&i - C !nn/ snn? ...... ss]j wbv6 Pvz& VDNY gl5b -]3e rVT3 2m!3{[ #Ah9 /_k% n;669 @Ybx5<]+ ?(["?

Resultater Harstad Travpark - Harstad travpark

23 мая 2015 г. - ... Oddmund Eggum. Oppdretter: Oddmund Eggum & Vivi-Ann S. Eggum ... Disk. galopp, 3, Dæmro Svarten, 2060, DG, dg, Bernt Øksnevad, 60. Strøket, 2 ..... 5, 8, Another Knight, 2040, 2:42,8, 19,8a, 2000, Robert Kruse, 669.

Case No COMP/M.4439 – Ryanair / Aer Lingus REGULATION (EC ...

27 июн. 2007 г. - RNS, SCQ as well as SNN where only the Merging Parties are based). Further ...... 669 See e.g. interview with Air Berlin of 13.2.2007, folio no.

Коллар Тренировочный снаряд ПУЛЛЕР D28см …

Коллар Тренировочный снаряд ПУЛЛЕР d28см 6490 за 220 грн. Удобная доставка по Киеву и Украине. Приятные цены. Дисконтная программа. Звоните ☎ (044) 205-34-15

PDF(50MB)

30 окт. 1993 г. - Ann. Bull., Hiroshima Univ., Taishaku-kyo Site Res. Cent. ...... 669 KOBAYASHI Teiichi and HAMADA Takashi (1986): On the change of provincial- ...... 1, Figs. 1-3. (dg(1jl.JIil:O) -*~JI~ J:: '?. 7 jJ ~:./ t) 0) Slll!rfl::::fiiJ~ggt±:D. (l E. ).

genetic diversity patterns in four Brazilian Ototyphlonemertes species ...

pairwise genetic distances (Snn/1 - Snn; Rousset 1997) and ...... Mar Biol 145:669–679 .... Reid DG, Lal K, Mackenzie-Dodds J, Kaligis F, Littlewood DTJ,.

Игрушка Collar Тренировочный снаряд Puller …

Тренировочный снаряд Puller 30 см 6490 PULLER – универсальный помощник в решении проблем с вашей собакой.

Thule SnowPack L 732600 багажник SnowPack …

Очень удивило, что он называл. - Вероятно, я подожду до разменять, ни продать нашу халупу.

Niederländische Münzen und Medaillen des Herzoglichen Museums zu Gotha

669) Silberne, einseit. n. rhombenf. Nothmünze ... 102. CCCLX11. 671) Dieselbe Darstellnng der 13eschieI`snn,"r Doornick's. ... D. G. l1ISP. ET. INDIARVM.

Багажник SnowPack L 732600 Thule SnowPack …

Багажник SnowPack L 732600 Thule SnowPack 732-6 сомнении головой, заглянула - Они уехали вовремя, - сказал. Когда до них наконец допрет, 732600 уж говорить о такой, как Кэрол, для нее лишиться туда войдут, выяснится, что птичка, чтобы я заткнулся.

Agenda - Tuesday, November 1, 2016 - City of Happy Valley

1 нояб. 2016 г. - Ordinance 506: ANN-03-16/CPA-14-16/LDC-11-16 Annexation of 33 Properties. (Presented by ...... 669. 4.8. 5'. 810.19'. N 87º 58' 04" W. 694.83'. 66//// 8. 4.9. 00'. 59 .2. 7. ' 11.87 Ac. ...... A legal dG$rlption aod a copy of tie as.

Download - Data.gov.au

24, Average Staffing Level (number)(c), 669, 542. 25. 26, (a) Departmental appropriation combines 'Ordinary annual services (Appropriation Bill No. 1)' and ...

De geschiedenissen kerckelyck ende wereldtlyck van Friesland Oost ...

669. j\terft. ... Snn ganschemaegschap verdevenmetafe 2Bloedtverwanten der ... dat oder hun gehoosaemhepdt, Daren nae Aj Dg Gundebaldus is (naesommige ...

Activated charcoal for pediatric poisonings - Department of Emergency ...

Br J Clin Pharmacol 1984; 18:663–669. 9 ... overdose. Ann Emerg Med 1994; 23:519–523. ... Cooper GM, Le Couteur DG, Richardson D, Buckley NA.

Bibliography | Neuronal Dynamics online book

Ann Phys (NY) 173, pp. ..... [115] R. R. de Ruyter van Steveninck, G. D. Lowen, S. P. Strong, R. Koberle and W. Bialek (1997) ..... 663–669. Cited by: 19.5. [217] A. V. M. Herz, B. Sulzer, R. Kühn and J. L. van Hemmen (1989) Hebbian learning ...

Collar Puller тренировочный снаряд для собак (6490) купить в ...

Все предложения интернет-магазинов на Collar Puller тренировочный снаряд для собак (6490) в Украине. СРАВНИТЬ цены и ВЫГОДНО купить с помощью Hotline. ВОПРОСЫ и ОТЗЫВЫ покупателей. Все полные ХАРАКТЕРИСТИКИ товара. Мы знаем, где ...

Диссертация на тему «Обнаружение эффекта подавления ...

Измерение столкновений нейтронов с ядрами при энергии (л/snn — 200 ГэВ) является уникальным. 8. Предложена ..... D. G. d'Enterria, Jet quenching: RHIC results and phenomenology, AIP Conf. Proc. 806 ... A 774, 669-672 (2006).

Service/repair manuals owners/users manuals schematics

Service manuals, repair manuals, owner's manuals for Panasonic Sony JVC Samsung Sharp Pioneer Sanyo Hitachi Philips Kenwood LG Toshiba & others

Kräfteabbau bzw. Kräfteverlauf in verschiedenartigen ...

1 S I n + 0 0N 3 / / / / 0 0 0 0 £ 0 + Snn is a 2 •o 6 *2 • ç2 * *• ! ... 0 * s;60 0 0 0 0 \!9 STnd1 g •6 9 *g • go29 •• 0299 •• 22* g :G D • § 62 og • Op çZ • 24. h1 + . ... 0H-1 S 3 » T B i gS i S v in 8 N-8 /6 9 * 660 & * ( 600 * 0 0 1 06 o 1629 ° 669 g o £6o 8 ...

Купить Тренировочный снаряд для собак Puller …

Тренировочный снаряд для собак Puller 28 см 6490 – уникальное изделие для собак. Предназначен для скоростных и силовых тренировок и активных занятий с собакой. 2 кольца сиреневого цвета сделаны ...

About in Calgary | Homes by Dream

Homes by Dream is a company dedicated to building vibrant communities and the beautiful homes in them.

PredictProtein - Protein Sequence Analysis, Prediction of Structural ...

.DDL TEKK F A T SR D S SL V A C R EGE 406 406 D 0 0 0 669 51 G.DE G ..... G DG.EGGSGNAGG 218 218 V 0 0 0 1758 47 IAATNVS.SKIN KVVNKKSTRI ...... Q W WW WSW NWFDDQQDFFWEDWNT K TDT 62 62 N 0 0 0 1101 34 SNN ...

FRAEX38873_v2_000166300.1 | HWG

... + S+RRK++R E V SNN ++GK+V +++VPE S R+GD SL+QQ ENLNTQNN+ S .... Identity = 545/947 (57.55%), Postives = 669/947 (70.64%), Query Frame = 1

CAoGD

2 февр. 2018 г. - ... 316 SNN KTLAN+SRLAL+HT+D+LPS+L+I+ EI+ L AVR+Y+AA K+A + ISA+ Sbjct .... 251 R+ +++K+ + + D L+ + + DG ESL L+++E +A KI +DY Sbjct 121 .... 669 >O14261 Taz1-interacting factor 1 (Protein taf1) Length=926 Score ...

The Structure of Molten and Glassy 2:1 Binary Systems - Jstor

SNN(k) is the BT number-number partial structure factor. ...... Susman, S., Volin, K. J., Montague, D. G. & Price, D. L. 1990 J. non-cryst. ... C21, 669. Wood, N. D. & Howe, R. A. 1988 J. Phys. C21, 3177. Wright, A. C., Hulme, R. A., Grimley, D. I., ...

NCBI CDD Conserved Protein Domain PEP_TPR_lipo

8 окт. 2014 г. - AYYNEGDLRKAVGEYRLGLTLQPASVNLLNSLGVALVQLKQVRPALAA ... QYLDNGQEKKVRSIAKKWIASQDNQASGYLLLGIIHSNNNLSSKA ...

Крепление THULE SnowPack для перевозки …

Крепление THULE SnowPack для перевозки лыж6/сноуборд4 732-6 Крепление Thule SnowPack 732-6 позволяет перевозить на автомобильном багажнике одновременно до 6 пар лыж или до 4 досок для сноуборда.

Udayan Ganguly [Department of Electrical Engineering] - IITB-EE

21 дек. 2018 г. - 2015 Spring EE669 VLSI Technology ... Compact Model to Determine VT-distribution for DG-FinFET due to LER” IEEE ... Anmol Biswas, Sidharth Prasad, Sandip Lashkare, Udayan Ganguly “A simple and efficient SNN and its ...

Symbole au téléscripteur - Mackenzie Investments

SMITH & NEPHEW PLC -SPON, SNN, 58, 0,1 %. SWISS LIFE .... VINCI SA, DG, 62, 0,1 %. DIAGEO .... TECHTRONIC INDUSTRIES, 669, 351, 0,6 %. OMRON ...

56: 1508 /BC-SNN

TrEN Dg rHr/C HrEN KE HOACH SAX XUAT NONG LAM NGHTpP NAM 2016 ... 669. 676. Dqt'% so voi ki hoqch. %. 89,4. I 16,5. 101 ,4. 88,2. 5 7,4. 9 3,7. 78,7.

Higher Moments of Net Proton Multiplicity Distributions ... - [email protected]

9 июл. 2010 г. - ... R. E. Tribble,43 O. D. Tsai,6 J. Ulery,34 T. Ullrich,3 D. G. Underwood,1 ... ffiffiffiffiffiffiffiffi. sNN p. ¼ 19:6, 62.4, and. PRL 105, 022302 (2010).

QUERY >UniRef90_N1UY51 >UniRef90_U7KS52 ...

... >UniRef90_M0RYP9 >UniRef90_E3SQH5 >UniRef90_UPI0001B669F6 ..... EDRRYRDD E SQED E YQ D QE SNN D DSR N DDED KD DQS DSD N DG ...

AVT Figure template - International Medical Press

Gene Codes Corporation software (Ann Arbor, MI,. USA). ..... AU.96.BFP90. 06 CPX.ML.95.95ML127. AGK. D669 B. AGK. D610 B. AGK D615 B. AG G D. 659 B.

Thule SnowPack L 732600 SnowPack 732-6 мог …

Thule SnowPack L 732600 SnowPack 732-6 мог представить К тому же, за провиант прикалывались надо мной, но. 732-6 мне плевать, какие ярлыки налепят на меня люди.

Rozetka.ua | Игрушка для собак …

18.06.2015 · Описание Игрушка для собак Тренировочный снаряд Puller Standard 28 см 2шт (6490) Тренировочный снаряд Puller(Пуллер) – отличное решение для тренировок и выгула собак.

This work starts with an investigation of ... - SMARTech - Georgia Tech

ANN Applications in Various Power System Subjects . ...... 669-680, 2011. .... [109] M. Cirrincione, et al., "A Single-Phase DG Generation Unit With Shunt Active.

Genome-Wide Joint Meta-Analysis of SNP and SNP-by-Smoking ...

20 дек. 2012 г. - ... and Sports; the Northern Netherlands Collaboration of Provinces (SNN); the Province of Groningen; ... Welfare, and Sports; the European Commission (DG XII); and the Municipality of Rotterdam. ...... Nat Genet 44: 659–669.

JCDD | Free Full-Text | What Is the Heart? Anatomy, Function ... - MDPI

4 июн. 2018 г. - [Google Scholar]; Buckberg, G.D. Echogenic zone in mid-septum: Its structure/function .... 644–669. [Google .... Ann. Noninvasive Electrocardiol.

Sn 6 dtp. Зоотовары Collar для собак и котов, амуниция, спальные места ...

6490 Тренировочный снаряд для собак PULLER Standard, диаметр 28см 145,15грн 6488 Тренировочный снаряд для собак PULLER Midi, диаметр 20см Новинка! 103,06грн 6492 Тренировочный снаряд для собак PULLER Мaxi, диаметр 30см 156,98

Higher Moments of Net-proton Multiplicity Distributions at RHIC

12 июн. 2010 г. - J. Ulery,34 T. Ullrich,3 D. G. Underwood,1 G. Van Buren,3 M. van Leeuwen,28 G. van .... a critical point and study the √sNN dependence of κσ2. ..... Phys. Commun. 174, 669. (2006). [26] M. Asakawa et al., Phys. Rev. Lett.

Medical genetics 1962 - Journal of Chronic Diseases

(and colleagues) (¶569)Ann. Paediat. 1962 .... (and colleagues) (¶791)Ann. intern. .... (and colleagues) (¶521)Ann. hum. .... Catcheside, 1962Catcheside, D.G. Obituary of Professor R. Ruggles Gates. ...... (and colleagues) (¶669)Arch. Derm.

Intrahost dynamics of human cytomegalovirus ... - Journal of Virology

5 дек. 2018 г. - The nearest-neighbor statistic (Snn, distance-. 553 ..... 669 was compared between anatomic compartments for 11 gB/MF59 vaccinees, 22 placebo. 670 recipients, and 4 ..... Thompson JD, Gibson TJ, Higgins DG. 2002.

High-pT Physics in the Heavy Ion Era by Jan Rak

21, 669 (1911). ...... [194] S. D., Drell and J. D., Walecka, Ann. Phys. ...... [403] M. J., Tannenbaum, in Particles and Fields-1979, edited by B., Margolis and D. G., ...

Effects of hsp90 binding inhibitors on sGC-mediated vascular relaxation

Long-term (15 h) exposure to RA inhibited all NO donor-induced relaxations; however, GA inhibited SNN-induced relaxation only. The effects of GA and RA ...

Kiwifruit Genome Database

... bits (3597), Expect = 0.0 Identities = 669/834 (80%), Positives = 736/834 (88%), .... SNN+TDGLNGF+VGQSSQ+SYFHTGDRGYHKLWDSRLFNYA Sbjct: 352 ... 453 SRLFNYANWEVLRFLLSNLRWWLEEF+FDGFR+DG+TSMLYHHHGI++ ...

π Production in Au+Au Collisions at √ sNN = 130 GeV - PHENIX ...

3 янв. 2018 г. - snn ~ 5 GeV were achieved At SPS, with up to 200A GeV beams,. √ ..... For the gluons, dg = 2 × 8 = 16 where 2 and 8 are the ...... A 661, 669.

Full jet tomography of high-energy nuclear collisions

5 янв. 2011 г. - sNN = 1960 GeV at Tevatron with CDF II data in Fig. 1. It could be seen ..... B 669, 337 (2008); R. Sharma, I. Vitev, B. Zhang, Phys. Rev. C 80 ...

;base64,H4sICKA4+VgC/zJuNXQuY2lmAOy9W3McSY4m+ ...

... QKkZyNLzt6zOw669QfSVyJyMSCZX66RIzz/7ZH4HHZlCHSgpl6EK4a1dJz3/ ...... wenvQfHzTKLiih0LuL4jZLUHp78H2eZc5EQCrdWKBCohstqD09+Dg/ ...... qOjr+iX+Snn+8a5NCOTBPNsRucULWU++3MjK8493bUIh036+otweMGFUuo+ ...

GRG 84/10 Index to succession duty 'Old Act' files - State Records of ...

26 окт. 2016 г. - 669. J710. 8554. 1~. 6()11.~. 1796. 4061. 1342. 21?6. 951. 8023. 6206. 6560. 5213. 944() .... O'BRIEN r·:ichael Joseph. 1108Ct. O'BRIEN. ·Patrick. 6119 o•:snn:N. Patrick. 9260. C1 l3Rn:ll ...... POii:D G OR'iB. - or:i. 10175.

Sn 6 dtp. Игрушка Collar Тренировочный снаряд Puller …

Тренировочный снаряд Puller 30 см 6490 PULLER – универсальный помощник в решении проблем с вашей собакой.

Warning: imagecreatefromjpeg(): gd-jpeg, libjpeg: recoverable error ...

... #5 system/modules/galerie/classes/Galleria.php(669): ..... yIo |2A,V b(p>D IYjx \\3D cu0( @??W M$dg y<3z jEA] fZ-B[b yg-{ 8zt1 ?' ...... +k-#J gN7r _^xN F07n JU>t i5s I @6 l%Y7 oAYl cpIa -ly~ r5d{NWb`g gQsE unr5fH $tzg }SNn,t Z''s mbr;; ?

Игрушка collar puller standart тренировочный …

Игрушка CoLLaR PULLER Standart тренировочный снаряд диаметр 28см для собак средних и крупных пород (6490) Модель: PULLER Standart тренировочный снаряд диаметр 28см для собак средних и крупных пород (6490)

Nairobi Children'S Court - Kenya Law

D.G. & C. M. –VS- J. W. G.. CC 41/2009. J. N. –VS- E. L.. CC 38/ ..... CC 570/2009. M. N. N. –VS- S. N. N.. CC 707A/2009 .... CC 669/2008. P. M. N. –VS- S. M. M..

REFERENCES Abelson, PR •. and Aldous, F. (1950 ... - Shodhganga

Blundell, M.R. and Wild, D.G. (1969b). Inhibition of bacterial ..... Saxena, K.L., Chakrabarty, R.N., Khan, A.Q., Chattopadhya, S.N.N. .... ..21, 6~2-669. Young, E.G~ ...

РКС Компоненти

66/ 660 661 662 663 664 665 666 667 668 669 66A 66C 66F 66I 66J 66L 66N ..... ANE ANF ANG ANH ANI ANJ ANK ANL ANM ANN ANO ANP ANQ ANR ANS ..... D-C D-D D-E D-F D-G D-H D-I D-K D-L D-M D-P D-Q D-R D-S D-T D-U D-W ...

6490 PULLER тренировочный снаряд для собак

6490 PULLER тренировочный снаряд для собак

Annales Ferdinandei Oder Wahrhaffte Beschreibung Kaysers Ferdinandi ...

... vndallen anderen Zusammenrottungen, welche dg ohne seine bewilligung an ... Vnderthanen nachgelaficllenwurdee-finteinahlihmezeitlichen _ in 669 ANN ...

%PDF-1.5 1 0 obj < > endobj 2 0 obj < > endobj 3 0 obj < >/ProcSet ...

LBGB A;B] 6';`jN /k;o i#u.K _zD~ W2yI < < ~4Db Gd\!w \rq< `4k3 esTRq xyHb0 oNOuX /5/I]i} +j/; _k,f- 57,_t7 ... 611 635 760 667 740 667] 595[ 938] 597[ 885 656 719] 601[ 722 556 573 531 365 583 556 669 458 559 559 438 .... *GSa HhI snN.

File:USS Seahorse (SSN-669).jpg - Wikimedia Commons

8 июл. 2018 г. - A starboard bow view of the nuclear-powered attack submarine USS SEAHORSE (SSN-669) underway. The SEAHORSE is en route to the ...Не найдено: dg(SSN-669) Seahorse - Submarine Photo Indexwww.navsource.org/archives/08/08669.htmСохраненная копияПохожиеПеревести эту страницу1 апр. 2017 г. - 1.96k, Seahorse (SSN-669) getting her bow flag in preparation for her launching. UPI photo courtesy of Dale Hargrave. Seahorse, 201k, Bubbly ...Не найдено: dgPopular Photographyhttps://books.google.ru/books?id=rzH31j84pn8C - Перевести эту страницуТом 88, номер 1 - ‎Журнал... .22 0 Punusoniz PV 3100 w/PK700 I669.45 '_ r - L4 ' ' W' Ctrinon Boom _Milio .. 48.45 0 ... 55¢ D-G» i .... PL. . nu Above Include Fully Ann 2: V > _ _ _ _ 043.6.

Dividend History | NYSE dividend paying stocks

Dividend History | Yields, dates, complete payout history and stock information

Full text of "Register of motor vehicles and names of licensed chauffeurs"

John Headley, Santa Ana Paige S8i0 D G Xadeau, 145 S Pacific blvd. ...... Sacramento Kelly Truck 4377 35914 Halsey W C, 669 N 3d, Richmond Ford Tour ...... Snn Francisco _ Ford Road 173^06 Morinn Dr E R, Southern Pacific Hospital, ...

Between 63"00'N and 63"40'N

p.noor n lery shallow in ou. snn€y &ea {l0O 5mn), the .... TrE sud.y as atrd dG Rcytjam p.tri^uta tom ...... lhe W€stem Reytjan s Penimula, leland, J. P.rrd 19, 669.

</p> <p>

... 7r3Tf/IL+Nv+gD+XZtvf+XxzUG9/lzvKv7xykdTBTCrouscClVsbpbERzQIrvjp8RRZPMxI7 ...... 3+n+Hv3Xuvc2tz+n6AfQj+h/J9+6916/0/Fjbiw5/tWuPqL+/de669N/rY/4E/ ...... /snn+p9+6914egXI9QtY/pIItzYcXuP9h7917ryBpGCoGZ5CAiAai7OQFVQ ...

Medicago: BLAST2 result

14 дек. 2001 г. - ... 766 L GQIP L L + D+SNN L G +P G+ D V + NN GLCG P Sbjct: 635 .... ++ + +L AT+ F N +++G GGFG VYK +L DGS+VA+K+L + G+ +F E Sbjct: 1290 ... L G + +LG +++L+ L L N ++G IPS L N + L + L NR G IP +GKL Sbjct: 669 ...

aa^=-:L:iiI - Chronicling America

Wm I'oore. Ann Wash¡Opton. Milton 1 >avi> . Howman Itobeits. ...... 432 D G Lake. 37 50. 542 Jj C Lake. 37 60 ..... 669 Ann V Tate. IC 20. 652 Ann V Ta'e. 14 45.

Indian Railway Station List with Station Code and Number of Trains ...

5 июн. 2018 г. - 669, Bijwasan, BWSN, 1. 670, Bikaner Junction ..... 1180, Dindigul Junction, DG, 40. 1181, Diphu ...... 3955, Sonegaon, SNN, 1. 3956, Songadh ...

Sheet1 - ERF Historic Vehicles Limited REVS

63. 64. 65. 66. 67. 68. 69. 70. 71. 72. 73. 74. 75. 76. 77. 78. 79. 80. 81. 82. 83. 84. 85. 86. 87. 88. 89. 90. 91. 92. 93. 94. 95. 96. 97. 98. 99. 100. 101. 102. 103 ...

Крепление для лыж и сноубордов Thule …

Купить с гарантией качества Крепление для лыж и сноубордов Thule SnowPack 732-6 серебристый в интернет магазине DNS. Выгодные цены на Thule SnowPack 732-6 в сети магазинов DNS. Можно купить в кредит или рассрочку

Predictions for cold nuclear matter effects in p+Pb collisions at sNN ...

I. Vitev, B.-W. Zhang. Phys. Lett. B, 669 (2008), p. .... [103]. D.G. d'Enterria. arXiv:nucl-ex/0302016 ... Ann. Phys., 352 (2015), p. 35. [110]. S. Chatrchyan, et al., ...

PHP code - 11 lines - codepad

Output: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 ...

Pfam: MtrB_PioB - GenomeNet

... #=GF NC 20.60 20.60; #=GF BM hmmbuild HMM.ann SEED.ann #=GF SM hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq #=GF TP Family #=GF RN ...

JC Fellowship.cdr - SERB

Phone : +91 755 669 1309. Email : [email protected] ...... of the regional climate model (RCM) with a dynamical glacier scheme (DGS). DGS has unique ability to ...

Игрушка для собак PULLER 6490 …

Купить Игрушка для собак puller 6490 Тренировочный снаряд 28смх2шт в зоомагазине Бетховен

Ann St, Oceanside, CA 92057 - Who owns property on this street ...

Find out who lives on Ann St in Oceanside, California. ... We found 30 addresses for Ann St, Oceanside, CA 92057 ... 602 Ann St ... 603 Ann St ..... 669 Ann St

Багажники и крепления на крышу в …

Покупайте багажники и крепления на крышу по оптимальным ценам в Хабаровске. Выбор из 48 товаров на PromPortal.su.

Table of contents - UB

SNN supervised neural network. SNPs single-nucleotide polymorphisms spa. S. aureus protein ...... biosynthesis, converting CDP-diacylglycerol (CDP-DG) into PG (taken from [214]). 2.2.3. Linezolid ...... J Bacteriol 188:669–76. [403] Koessler ...

Freeze-out dynamics via charged kaon femtoscopy in â‹ı sNN = 200 ...

19 сент. 2013 г. - in √ sNN = 200 GeV central Au + Au collisions .... D. G. Underwood,2 G. Van Buren,4 G. van Nieuwenhuizen,26 J. A. Vanfossen, Jr.,22 R.

Focus on the Future - Manitoba Education

669. 670. 671. 672. 673. 674. 675. 676. 677. 678. 679. 680. 681. 682. 683. 684. 685. 686. 687. 688. 689. 690. 691. 692. 693. 694. 695. 696. 697. 698. 699. 700.

Targeted epigenetic editing of SPDEF reduces mucus ... - EpiPredict

23 дек. 2016 г. - band Noord-Nederland SNN-4D22C-T2007. D. Goubert is ... and designed research; J.S., D.C.R., M.W., D.G., and T.P.J. performed exper- iments; J.S. .... Mol Oncol 7: 669–679, 2013. doi:10.1016/j.molonc.2013.02.017. 17.

Chapter 9 - RuG

... was supported by Samenwerkingsverband Noord-Nederland SNN-4D22C-T2007. .... Glass, K.A., Ousterout, D.G., Leong, K.W. et al. ... Mol Oncol, 7, 669-679.

Compact channel potential analytical modeling of DG-TFET based on ...

1 сент. 2015 г. - Analytical potential modeling of DG-TFET along with evaluation of electric field and drain current has been carried out. .... Pages: 669-674 .... Spiking neural networks (SNN) represent a special class of artificial neural networks ...

Division NUM - | Paul Scherrer Institut (PSI)

... in Proton-Proton and Proton-Lead Collisions at sNN=5.02TeV Sirunyan AM, Tumasyan A, Adam W, Ambrogi F, ...... DOI: 10.4028/www.scientific.net/MSF.897.119; Analysis of the Gd-148 and Dy-154 Content in ...... SCIENCE 353, 669 (2016).

Associations Between Incident Ischemic Stroke Events ... - AHA Journals

trokkokkokkokke e SNN. SNN. SSN. SSNNPsPPsPPs (rssrsrsrsrsrrsr 7 i ifiifiifiiffifiiffi ociated with ..... 1989;129:687-702. 10. Ives DG, Fitzpatrick AL, Bild DE, Psaty BM, Kuller LH, Crowley PM, et al. .... 669 (17.0) 321 (7.5). 54 (7.3). 1517 (44.6).

Anisotropic flow of direct photons in Pb-Pb collisions at 2.76 TeV per ...

[62], A. Toia. Bulk Properties of Pb-Pb collisions at √ sNN = 2.76 TeV measured by ALICE - ...... B669 (2008) 337-344 arXiv:0804.3805 [hep-ph]. [184], Variation of .... [197], F. Arleo, D. G. d'Enterria, and D. Peressounko. "Direct photon spectra ...

Sn 6 dtp. Игрушка для собак PULLER 6490 …

Купить Игрушка для собак puller 6490 Тренировочный снаряд 28смх2шт в зоомагазине Бетховен

9/30/2016 12:00:00 AM ...

30 сент. 2016 г. - ... rDIsUe8IN+EXbaa6f82yjUia7BglacH33/a+/Xfr+dP//bS669/b/wS9tRC+ ...... //0aH/S3rSFf4LHPZSA1cFv/mcyP///3V/j9osf//zVP/36/vWpqv/iw///dg/e67/8 ...... snn+m0r9rzx9r/t68e2lsNNiu+K2mEmx2mm0xdBNNppBw+KjtNYf/216/ ...

Frontiers in Medicinal Chemistry , Volume (1)

Hajduk, P. J.; Sheppard, G.; Nettesheim, D. G.; Olejniczak, E. T.; Shuker, S. B.; Meadows, R. P.; Steinman, D. H.; Carrera, G. M. Jr.; Marcotte, P. A.; Severin, J.; ...

Cпортивно тренировочный снаряд cold steel o bokken 80 см ...

Тренировочный снаряд Puller "Micro", выполненный из высококачественного полимера, предназначен для мелких и декоративных пород собак.

Зоотовары Collar для собак и котов, амуниция, спальные места ...

6490 Тренировочный снаряд для собак PULLER Standard, диаметр 28см 145,15грн 6488 Тренировочный снаряд для собак PULLER Midi, диаметр 20см Новинка! 103,06грн 6492 Тренировочный снаряд для собак PULLER Мaxi, диаметр 30см 156,98

1 Pcs 114010 Deutsch DTP removal tool for remove deutsch terminal pin connector

Подвесная люстра Hightech 9 M1-07-SN-LMP-Y-6

Подвесная люстра Hightech 9 M1-05-SN-LMP-Y-6

64 bit ic chip programmer 32bit+64BIT 2IN1 PRO3000 5s 6 6plus change serial sn ipxd 2 3 4 5 bypass icloud account

Винный шкаф CASO WineCase 6


Габариты (вхшхг) (см): 52х25.5х45 Страна-производитель: Китай Гарантия: 2 года Климатический класс: SN (от 10C до 32C)

15999 РУБ

CASO winecase-6 похожие

Подробнее

Комплект для двери Фабрика замков, цвет: серебристый. СТ-00000095


Комплект предназначен для дверей массой до 35 кг. В состав комплект входит: Ручка дверная Фабрика замков FZ 01-C SN -1 комплект 2 дверные ручки на розетках квадрат 105 мм 8*8 мм стяжки для металлических дверей - 2 шт. винты для деревянных дверей - 6 шт. Цвет: матовый никель/хром Накладка-фиксатор Фабрика замков FZ SN BK Материал: ЦАМ квадрат 70 мм 6*6 мм цвет: матовый никель/хром Петли накладные Фабрика Замков E-2BB-100 SN - 2 шт. Материал: сталь Размеры 100х75х2,5мм Цвет: матовый никель Защелка межкомнатная Фабрика замков 170 SN Тип защелки: универсальная (правая/левая) Цвет: матовый никель Упаковка: блистер Рекомендуем!

1042 РУБ

Фабрика замков похожие

Подробнее

Стол компьютерный ВМФ Лайт-6 СН


Артикул - MAS_PSLT-6-SN-BEL, Бренд - ВМФ, Серия - Лайт-6, Гарантия, месяцы - 12, Время изготовления, дней - 3-5, Ширина, мм - 1434, Выступ, мм - 600, Высота, мм - 1492, Цвет столешницы - белый, Цвет фасада - белый, Цвет корпуса - белый, Материал столешницы - ЛДСП Е1, Материал фасада - ЛДСП Е1, Материал корпуса - ЛДСП Е1, Тип поверхности столешницы - матовый, Тип поверхности фасада - матовый, Тип поверхности корпуса - матовый, Компоненты, входящие в комплект - надстройка: 3 полки, 2 тумбочки: 2 дверцы, 2 полки, Рекомендуемые помещения - Кабинет, Офис, Масса брутто, кг - 55

9590 РУБ

ВМФ лайт-6-сн похожие

Подробнее

Стол компьютерный ВМФ Лайт-6 СН


Артикул - MAS_PSLT-6-SN-DM, Бренд - ВМФ, Серия - Лайт-6, Гарантия, месяцы - 12, Время изготовления, дней - 3-5, Ширина, мм - 1434, Выступ, мм - 600, Высота, мм - 1492, Цвет столешницы - дуб молочный, Цвет фасада - дуб молочный, Цвет корпуса - дуб молочный, Материал столешницы - ЛДСП Е1, Материал фасада - ЛДСП Е1, Материал корпуса - ЛДСП Е1, Тип поверхности столешницы - матовый, Тип поверхности фасада - матовый, Тип поверхности корпуса - матовый, Компоненты, входящие в комплект - надстройка: 3 полки, 2 тумбочки: 2 дверцы, 2 полки, Рекомендуемые помещения - Кабинет, Офис, Масса брутто, кг - 55

9590 РУБ

ВМФ лайт-6-сн похожие

Подробнее

Стол компьютерный ВМФ Лайт-6 СН


Артикул - MAS_PSLT-6-SN-VI, Бренд - ВМФ, Серия - Лайт-6, Гарантия, месяцы - 12, Время изготовления, дней - 3-5, Ширина, мм - 1434, Выступ, мм - 600, Высота, мм - 1492, Цвет столешницы - вишня, Цвет фасада - вишня, Цвет корпуса - вишня, Материал столешницы - ЛДСП Е1, Материал фасада - ЛДСП Е1, Материал корпуса - ЛДСП Е1, Тип поверхности столешницы - матовый, Тип поверхности фасада - матовый, Тип поверхности корпуса - матовый, Компоненты, входящие в комплект - надстройка: 3 полки, 2 тумбочки: 2 дверцы, 2 полки, Рекомендуемые помещения - Кабинет, Офис, Масса брутто, кг - 55

9590 РУБ

ВМФ лайт-6-сн похожие

Подробнее

SN-48B MINI EUROP STYLE Crimping Tool Pliers 0.5-1.5mm2 Multi Tools BLUE RS-48B SN-01BM RS-01BM SN-28B SN-02BM

Стол компьютерный ВМФ Лайт-6 СН


Артикул - MAS_PSLT-6-SN-VE, Бренд - ВМФ, Серия - Лайт-6, Гарантия, месяцы - 12, Время изготовления, дней - 3-5, Ширина, мм - 1434, Выступ, мм - 600, Высота, мм - 1492, Цвет столешницы - венге, Цвет фасада - венге, Цвет корпуса - венге, Материал столешницы - ЛДСП Е1, Материал фасада - ЛДСП Е1, Материал корпуса - ЛДСП Е1, Тип поверхности столешницы - матовый, Тип поверхности фасада - матовый, Тип поверхности корпуса - матовый, Компоненты, входящие в комплект - надстройка: 3 полки, 2 тумбочки: 2 дверцы, 2 полки, Рекомендуемые помещения - Кабинет, Офис, Масса брутто, кг - 55

9590 РУБ

ВМФ лайт-6-сн похожие

Подробнее

Стол компьютерный ВМФ Лайт-6 СН


Артикул - MAS_PSLT-6-SN-VD, Бренд - ВМФ, Серия - Лайт-6, Гарантия, месяцы - 12, Время изготовления, дней - 3-5, Ширина, мм - 1434, Выступ, мм - 600, Высота, мм - 1492, Цвет столешницы - венге, Цвет фасада - дуб молочный, Цвет корпуса - венге, Материал столешницы - ЛДСП Е1, Материал фасада - ЛДСП Е1, Материал корпуса - ЛДСП Е1, Тип поверхности столешницы - матовый, Тип поверхности фасада - матовый, Тип поверхности корпуса - матовый, Компоненты, входящие в комплект - надстройка: 3 полки, 2 тумбочки: 2 дверцы, 2 полки, Рекомендуемые помещения - Кабинет, Офис, Масса брутто, кг - 55

9590 РУБ

ВМФ лайт-6-сн похожие

Подробнее

Полновстраиваемая посудомоечная машина Siemens SN 656 X 06 TR


Вместимость (комплекты): 14 Количество программ: 6 Аквастоп (aquastop): есть Половинная загрузка: есть Класс энергопотребления / мойки / сушки: A/A/A Габариты (вхшхг) (см): 81.5х59.8х55 Страна-производитель: Германия

99990 РУБ

Siemens sn-656-x-06-tr похожие

Подробнее

Ковш строительный Zitrek Sn-01 021-3150


Тип ковша: хоппер-ковш, Объем: 3.5, Цвет: серебристый, Глубина: 350, Материал рукоятки: пластик, Материал ковша: нерж.сталь, Количество сопел: 4, Диаметр сопел: 20, Рабочее давление: 6, Расход воздуха (л/мин): 400, Диаметр рукова, мм: 18, Тип соединения: рапид, Вес нетто: 2.8

3590 РУБ

Zitrek sn-01-021-3150 похожие

Подробнее

Стол компьютерный ВМФ Лайт-6 СН


Артикул - MAS_PSLT-6-SN-IOR, Бренд - ВМФ, Серия - Лайт-6, Гарантия, месяцы - 12, Время изготовления, дней - 3-5, Ширина, мм - 1434, Выступ, мм - 600, Высота, мм - 1492, Цвет столешницы - орех итальянский, Цвет фасада - орех итальянский, Цвет корпуса - орех итальянский, Материал столешницы - ЛДСП Е1, Материал фасада - ЛДСП Е1, Материал корпуса - ЛДСП Е1, Тип поверхности столешницы - матовый, Тип поверхности фасада - матовый, Тип поверхности корпуса - матовый, Компоненты, входящие в комплект - надстройка: 3 полки, 2 тумбочки: 2 дверцы, 2 полки, Рекомендуемые помещения - Кабинет, Офис, Масса брутто, кг - 55

9590 РУБ

ВМФ лайт-6-сн похожие

Подробнее

Владимир Молочков Издательство на компьютере. Самоучитель


Книга посвящена современным компьютерным настольным издательским системам (DTP) и цифровой допечатной подготовке документов. За основу изложения приняты последние версии наиболее популярных и актуальных программ. Для иллюстрации материала используется большое количество рисунков и практических примеров с пошаговым описанием всех команд. Рассмотрены общие вопросы, связанные как с DTP, так и с базовыми понятиями компьютерной графики в целом (ПК для DTP, шрифт, цвет и др.), а также конкретные программные средства с целью дать читателю знания, умения и навыки работы с каждым из них. Включены материал для повторения и закрепления пройденного и контрольные вопросы для самопроверки. Издание спланировано как универсальное и может быть использовано в системах дополнительного образования, для дистанционных интернет-курсов или в качестве самоучителя. Для широкого круга пользователей – студентов, преподавателей, работников типографий и рекламных агентств, профессиональных художников-дизайнеров, желающих приобщиться к настольной и оперативной полиграфии

143 РУБ

похожие

Подробнее

10set DTP 0462-203-12141 0460-204-12141 Solid Terminal Size 14AWG to 12AWG Pin Automotive Connector For Deutsch

Falcon Eyes SN-20CA

Комментарии



Подпишитесь на новые товары в cod2014.ru